(£) GBP (Default)
  • ($) USD
  • (€) EUR
  • ($) AUD
  • ($) CAD
  • ($) NZD

LL-37 Thymosin Alpha-1 Peptide Stack

The combination of LL-37 (CAP 18) and Thymosin Alpha-1 peptides presents a promising approach in biomedical applications, particularly due to their immunomodulatory properties. LL-37, an antimicrobial peptide, is known for its ability to stimulate host defence against microbes and reduce pro-inflammatory cytokine responses. Meanwhile, Thymosin Alpha-1 can prime dendritic cells and enhance Th1 and Treg cells, helping to balance inflammation, making it a commonly used immune enhancer in viral infectious diseases.

This LL-37 Thymosin Alpha-1 peptide stack contains:

LL-37 (Cap-18) 5mg peptide vial

Thymosin Alpha-1 10mg peptide vial

Save 10% based on buying vials individually.

 

£96.01

SKU PG: LL-37 5mg Thymosin Alpha-1 10mg Vial Stack Categories , , , ,

489 in stock

Description

LL-37 Thymosin Alpha-1 Peptide Stack Germany

The combination of LL-37 Thymosin Alpha-1 peptides is a promising approach in the biomedical field due to their immunomodulatory properties. Both these peptides have been extensively studied for their potential therapeutic applications, and their combined use has opened new avenues of Germany research. In particular, the combination of LL-37’s ability to control inflammation and Thymosin Alpha-1’s capacity to boost immune function can be incredibly beneficial in treating conditions that involve an overactive immune response or require a boosted immune reaction.

Recent Germany studies have focused on the development of a hybrid peptide LL-37Tα1, which combines the properties of both LL-37 and Thymosin Alpha-1. This hybrid peptide is being explored for its potential biomedical applications. The fusion of these two peptides aims to leverage their combined benefits, potentially offering enhanced therapeutic effects compared to their individual use. As such, this hybrid peptide could potentially be employed in the treatment of autoimmune diseases, viral infections, cancers, and other conditions that necessitate immune modulation. Whilst the blended peptide is still under investigation, Pharma Grade Store Germany offers this LL-37 Thymosin Alpha-1 peptide stack for research purposes.

 

LL-37 (CAP-18)

LL-37, also known as CAP-18, is an antimicrobial peptide that has been shown to stimulate host defenses against various microbes. It reduces pro-inflammatory cytokine responses, making it an effective tool in controlling inflammation. This peptide is known for its antimicrobial, antiviral, and antifungal properties, making it a versatile weapon in the human body’s arsenal against pathogens. Germany Research has demonstrated LL-37’s ability to affect both planktonic bacteria and those residing in biofilms, as well as viruses such as HIV and various fungi. Furthermore, LL-37 suppresses the production of pro-inflammatory cytokines, such as TNF-α and IL-6, in infected monocytes. The peptide is also known to increase cytokine and chemokine liberation.

Amino Acid Sequence: [LL-37, 37 aa]

Molecular Formula: C205H340N60O53

 

Thymosin Alpha-1

Thymosin Alpha-1, on the other hand, is a synthetic version of a naturally occurring peptide found in the thymus gland. It modulates host immune responses and has been used as an immune enhancer in various viral infectious diseases. Thymosin Alpha-1 can prime dendritic cells, enhance Th1 and Treg cells, and help balance inflammation. It has been shown to be beneficial in boosting immune function and fighting inflammation.

Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH

Molecular Formula: C129H215N33O55

References:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6587124/

https://www.mdpi.com/2309-608X/6/4/241

https://www.researchgate.net/publication/7066014

 

Buy LL-37 Thymosin Alpha-1 Peptide Stack Online From Pharmagrade Store Today!

 

DISCLAIMER: We do not supply Peptides or Sarms to any individual under the age of 21. You must be a licensed and qualified healthcare practitioner. All products listed on this website (https://ger.pharmagrade.store) and provided through Pharma Grade Germany are intended ONLY FOR medical research purposes. Pharma Grade does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption) nor are the products intended as a drug, stimulant or for use in any food products.

Disclaimer

We do not supply Peptides or Sarms to any individual under the age of 21. You must be a licensed and qualified healthcare practitioner. All products listed on this website (https://ger.pharmagrade.store) and provided through Pharma Grade are intended ONLY FOR medical research purposes. Pharma Grade does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption) nor are the products intended as a drug, stimulant or for use in any food products.